PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_09988
Common NameKK1_010272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TALE
Protein Properties Length: 244aa    MW: 28056.1 Da    PI: 6.5166
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_09988genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.8e-101742082155
                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                    k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  C.cajan_09988 174 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 208
                    569*****************************885 PP

2ELK38.91.9e-13128149122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK qLlrKYsgyLgsLk+EF+
  C.cajan_09988 128 ELKVQLLRKYSGYLGSLKKEFL 149
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037902.5E-16137IPR005540KNOX1
SMARTSM012555.4E-9138IPR005540KNOX1
SMARTSM012561.4E-264798IPR005541KNOX2
PfamPF037914.4E-225096IPR005541KNOX2
PROSITE profilePS5121311.139128148IPR005539ELK domain
PfamPF037891.4E-9128149IPR005539ELK domain
SMARTSM011887.1E-7128149IPR005539ELK domain
PROSITE profilePS5007112.228148211IPR001356Homeobox domain
SuperFamilySSF466891.28E-19150222IPR009057Homeodomain-like
SMARTSM003892.8E-12150215IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-28153214IPR009057Homeodomain-like
CDDcd000865.23E-13160212No hitNo description
PfamPF059201.9E-17168207IPR008422Homeobox KN domain
PROSITE patternPS000270186209IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MAHPLFPRLL SSYLNCLKVG APPEVVASLE ESCAKCESLN ASSGRTGSGS IGEDPALDQF  60
MEAYCEMLIK YEQELTKPFK EAMLFFSRIE CQLKALAVSS DFGQSESSSQ NEVDVHENNL  120
DSQAEDRELK VQLLRKYSGY LGSLKKEFLK KKKNGKLPKE ARQQLLDWWN RHYKWPYPSE  180
SQKQALAEST GLDLKQINNW FINQRKRHWK PSEDMQFAVM DATNYYMENV MCKPFPMDGM  240
PMLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280610.0EF128061.1 Medicago truncatula class I KNOX homeobox transcription factor (KNOX6) mRNA, complete cds.
GenBankGU4616040.0GU461604.1 Medicago truncatula KNOX6 variant a mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502681.10.0PREDICTED: homeobox protein SBH1-like isoform X1
RefseqXP_014502682.10.0PREDICTED: homeobox protein SBH1-like isoform X2
SwissprotP466081e-119HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A151TVC90.0A0A151TVC9_CAJCA; Homeobox protein SBH1
TrEMBLA0A0S3RK690.0A0A0S3RK69_PHAAN; Uncharacterized protein
TrEMBLV7B6U20.0V7B6U2_PHAVU; Uncharacterized protein
STRINGGLYMA14G05150.21e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-103KNOX/ELK homeobox transcription factor